DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45263 and si:ch211-286b5.6

DIOPT Version :10

Sequence 1:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster
Sequence 2:XP_068078054.1 Gene:si:ch211-286b5.6 / 100003646 ZFINID:ZDB-GENE-121214-216 Length:401 Species:Danio rerio


Alignment Length:251 Identity:61/251 - (24%)
Similarity:101/251 - (40%) Gaps:54/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GDCSLWIRSATLDFDDGLWECQVTASDFTTQDALTSQPVRLVVRVAPQRPRLEYEAVHVPPGHNI 190
            |:|||.:|...:. |.|::...:|  |.:..:...:|.|||  .|......::.::..|..|..|
Zfish    89 GNCSLVLRDVRVS-DAGIFSFMLT--DDSGHNWTNTQGVRL--EVTDVEVEVKTQSDVVMEGDWI 148

  Fly   191 TADAGALATVKCISHYGNPPATLKWFLGDQEISPIHPQMNATEPDNPRTWSATSVVQVSAMRERH 255
            ....|:     ||.....|  |..|    ::...:|.|           ....:::.|.::....
Zfish   149 FFSCGS-----CIPSMTVP--TYTW----RKDGHLHSQ-----------HYGNNMLDVESVMLED 191

  Fly   256 GDILRC-AAYHESYTAKSVVVEARLDVKYAP-------SIRLIGSPEIDLEEDKDALVLRCVADA 312
            |.:..| .:.||...:..|.:..|      |       |:.:.||..|   ...|::.|.|.:|:
Zfish   192 GGLYLCIISGHEGLNSTQVNITVR------PGGPPKSVSVSVSGSAVI---VSGDSVTLSCSSDS 247

  Fly   313 NPPA-SIVW-RRAGRSEIASLQETLQLRPVGRRDAGLYTCQAQNSVGT--SEQLSV 364
            |||| :..| :....|.:.|.|....|      |:|.|.|:|:|..|:  ||.:||
Zfish   248 NPPAVNFTWLKETQSSAVGSGQSFSAL------DSGRYYCEAENKYGSQRSESVSV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45263NP_731246.2 Ig 170..281 CDD:472250 19/111 (17%)
Ig strand B 198..202 CDD:409353 0/3 (0%)
Ig strand C 212..216 CDD:409353 1/3 (33%)
Ig strand E 244..248 CDD:409353 0/3 (0%)
Ig strand F 258..263 CDD:409353 1/5 (20%)
Ig strand G 274..277 CDD:409353 0/2 (0%)
Ig 304..364 CDD:409353 21/63 (33%)
Ig strand B 304..308 CDD:409353 1/3 (33%)
Ig strand C 317..321 CDD:409353 1/4 (25%)
Ig strand E 334..337 CDD:409353 0/2 (0%)
Ig strand F 347..352 CDD:409353 2/4 (50%)
Ig strand G 361..364 CDD:409353 0/2 (0%)
Ig_3 371..444 CDD:464046
Ig 475..568 CDD:472250
Ig strand B 487..491 CDD:409353
Ig strand C 501..505 CDD:409353
Ig strand E 536..540 CDD:409353
Ig strand F 550..555 CDD:409353
Ig strand G 563..566 CDD:409353
si:ch211-286b5.6XP_068078054.1 Ig 30..129 CDD:472250 13/44 (30%)
Ig strand B 40..44 CDD:409353
Ig strand C 58..61 CDD:409353
Ig strand E 91..95 CDD:409353 3/3 (100%)
Ig strand F 105..110 CDD:409353 0/4 (0%)
Ig strand G 119..124 CDD:409353 1/4 (25%)
Ig <161..214 CDD:472250 11/69 (16%)
Ig strand C 163..167 CDD:409353 2/7 (29%)
Ig strand E 180..184 CDD:409353 0/3 (0%)
Ig strand F 194..199 CDD:409353 1/4 (25%)
Ig strand G 207..210 CDD:409353 0/2 (0%)
Ig_2 236..298 CDD:464026 24/68 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.