DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7A and COX7A2L

DIOPT Version :9

Sequence 1:NP_001246986.1 Gene:COX7A / 50002 FlyBaseID:FBgn0040529 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_001305965.1 Gene:COX7A2L / 9167 HGNCID:2289 Length:114 Species:Homo sapiens


Alignment Length:78 Identity:28/78 - (35%)
Similarity:40/78 - (51%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FATTAGRRSAAVPKDQIEKGYFEIRKVQEHFQKKDGKPVFLKGSVVDNVLYRVTVALALVGIGGM 85
            |||.....|.:...|...|.  ::.::|:.|||.||.||:||..:.|.:|||.|:||.:.|....
Human    39 FATPTKLTSDSTVYDYAGKN--KVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYC 101

  Fly    86 GKLFYELSVPKKE 98
            ....|..|.||.:
Human   102 LIALYMASQPKNK 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7ANP_001246986.1 Cyt_c_Oxidase_VIIa 40..94 CDD:238468 19/53 (36%)
COX7A2LNP_001305965.1 Cyt_c_Oxidase_VIIa 56..110 CDD:238468 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CUDK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5465
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1548349at2759
OrthoFinder 1 1.000 - - FOG0001153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10510
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.