DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7A and Cox7a1

DIOPT Version :9

Sequence 1:NP_001246986.1 Gene:COX7A / 50002 FlyBaseID:FBgn0040529 Length:98 Species:Drosophila melanogaster
Sequence 2:XP_038949749.1 Gene:Cox7a1 / 687508 RGDID:6496527 Length:138 Species:Rattus norvegicus


Alignment Length:51 Identity:12/51 - (23%)
Similarity:17/51 - (33%) Gaps:17/51 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AGRRSAAVPKDQIEKGYFEIRKVQEH-----------------FQKKDGKP 58
            :|..:.|:|..|...|..|.|...:|                 .||.|.:|
  Rat    74 SGTEAEALPGRQRPPGALEGRGNGQHPVQTDHDADARGSLDKTGQKTDWRP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7ANP_001246986.1 Cyt_c_Oxidase_VIIa 40..94 CDD:238468 8/36 (22%)
Cox7a1XP_038949749.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CUDK
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1548349at2759
OrthoFinder 1 1.000 - - FOG0001153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10510
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1656
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.