powered by:
Protein Alignment COX7A and Cox7a1
DIOPT Version :9
Sequence 1: | NP_001246986.1 |
Gene: | COX7A / 50002 |
FlyBaseID: | FBgn0040529 |
Length: | 98 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038949749.1 |
Gene: | Cox7a1 / 687508 |
RGDID: | 6496527 |
Length: | 138 |
Species: | Rattus norvegicus |
Alignment Length: | 51 |
Identity: | 12/51 - (23%) |
Similarity: | 17/51 - (33%) |
Gaps: | 17/51 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 AGRRSAAVPKDQIEKGYFEIRKVQEH-----------------FQKKDGKP 58
:|..:.|:|..|...|..|.|...:| .||.|.:|
Rat 74 SGTEAEALPGRQRPPGALEGRGNGQHPVQTDHDADARGSLDKTGQKTDWRP 124
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CUDK |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1548349at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001153 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10510 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1656 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.920 |
|
Return to query results.
Submit another query.