DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7A and CG34172

DIOPT Version :9

Sequence 1:NP_001246986.1 Gene:COX7A / 50002 FlyBaseID:FBgn0040529 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_001097054.1 Gene:CG34172 / 5740746 FlyBaseID:FBgn0085201 Length:62 Species:Drosophila melanogaster


Alignment Length:48 Identity:18/48 - (37%)
Similarity:25/48 - (52%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FQKKDGKPVFLKGSVVDNVLYRVTVALALVGIGGMGKLFYELSVPKKE 98
            ||..:..||||||...|.:|:.:|..|..:||.....|.|.:...||:
  Fly    14 FQAVNELPVFLKGGPADKILFGITAGLCGLGIVSFVHLVYTMGFAKKK 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7ANP_001246986.1 Cyt_c_Oxidase_VIIa 40..94 CDD:238468 16/42 (38%)
CG34172NP_001097054.1 Cyt_c_Oxidase_VIIa 3..57 CDD:238468 16/42 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CUDK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1548349at2759
OrthoFinder 1 1.000 - - FOG0001153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10510
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.