powered by:
Protein Alignment COX7A and CG34172
DIOPT Version :9
Sequence 1: | NP_001246986.1 |
Gene: | COX7A / 50002 |
FlyBaseID: | FBgn0040529 |
Length: | 98 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097054.1 |
Gene: | CG34172 / 5740746 |
FlyBaseID: | FBgn0085201 |
Length: | 62 |
Species: | Drosophila melanogaster |
Alignment Length: | 48 |
Identity: | 18/48 - (37%) |
Similarity: | 25/48 - (52%) |
Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 FQKKDGKPVFLKGSVVDNVLYRVTVALALVGIGGMGKLFYELSVPKKE 98
||..:..||||||...|.:|:.:|..|..:||.....|.|.:...||:
Fly 14 FQAVNELPVFLKGGPADKILFGITAGLCGLGIVSFVHLVYTMGFAKKK 61
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CUDK |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1548349at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001153 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10510 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.920 |
|
Return to query results.
Submit another query.