DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7A and cox7a2l

DIOPT Version :9

Sequence 1:NP_001246986.1 Gene:COX7A / 50002 FlyBaseID:FBgn0040529 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_956268.1 Gene:cox7a2l / 335751 ZFINID:ZDB-GENE-030131-7691 Length:115 Species:Danio rerio


Alignment Length:98 Identity:30/98 - (30%)
Similarity:46/98 - (46%) Gaps:5/98 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSETLEIPLPTSNYAVVRSFATTAGRRSAAVPKDQIE-KGYFEIRKVQEHFQKKDGKPVFLKGSV 65
            |.:.|...:|:.:.|::....|.....|:|.    :| .|...:..:|..||..|..||.||..|
Zfish    22 SPQGLRANVPSESPAMIFGTPTKLVSESSAT----VEYMGKNRVPDLQRIFQASDNIPVHLKRGV 82

  Fly    66 VDNVLYRVTVALALVGIGGMGKLFYELSVPKKE 98
            .|.:|||.|:||.:.|:.......|..:.|||:
Zfish    83 PDRLLYRSTMALTVGGVLYCLVALYLAAQPKKK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7ANP_001246986.1 Cyt_c_Oxidase_VIIa 40..94 CDD:238468 19/53 (36%)
cox7a2lNP_956268.1 Cyt_c_Oxidase_VIIa 57..111 CDD:238468 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CUDK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1548349at2759
OrthoFinder 1 1.000 - - FOG0001153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10510
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.