DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7A and COX7A2

DIOPT Version :9

Sequence 1:NP_001246986.1 Gene:COX7A / 50002 FlyBaseID:FBgn0040529 Length:98 Species:Drosophila melanogaster
Sequence 2:XP_024302098.1 Gene:COX7A2 / 1347 HGNCID:2288 Length:115 Species:Homo sapiens


Alignment Length:81 Identity:29/81 - (35%)
Similarity:43/81 - (53%) Gaps:20/81 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TTAGRRSAAVPKDQIEKGYF--EIRKVQEHFQKKDGKPVFLKGSVVDNVLYRVTVALALVGIGGM 85
            :||.||            :|  ::.:.|:.||:.|..|::|||.|.|.:|||.|:.|.   :||.
Human    49 STASRR------------HFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILT---VGGT 98

  Fly    86 GKLFYELSV---PKKE 98
            ....|||:|   |||:
Human    99 AYAIYELAVASFPKKQ 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7ANP_001246986.1 Cyt_c_Oxidase_VIIa 40..94 CDD:238468 21/55 (38%)
COX7A2XP_024302098.1 Cyt_c_Oxidase_VIIa 56..110 CDD:238468 22/56 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5465
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1548349at2759
OrthoFinder 1 1.000 - - FOG0001153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110740
Panther 1 1.100 - - LDO PTHR10510
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8442
SonicParanoid 1 1.000 - - X1656
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.