DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7A and COX7A1

DIOPT Version :9

Sequence 1:NP_001246986.1 Gene:COX7A / 50002 FlyBaseID:FBgn0040529 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_001855.1 Gene:COX7A1 / 1346 HGNCID:2287 Length:79 Species:Homo sapiens


Alignment Length:86 Identity:32/86 - (37%)
Similarity:48/86 - (55%) Gaps:21/86 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AVVRSFATTAGRRSAAVPKDQIEKGYFE--IRKVQEHFQKKDGKPVFLKGSVVDNVLYRVTVALA 78
            |::|||::||..|             |:  :|:.|:.||:.:..|::|||.:|||:|||||:.|.
Human     9 ALIRSFSSTARNR-------------FQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLC 60

  Fly    79 LVGIGGMGKLFYEL---SVPK 96
            |   ||.....|.|   |.|:
Human    61 L---GGTVYSLYSLGWASFPR 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7ANP_001246986.1 Cyt_c_Oxidase_VIIa 40..94 CDD:238468 23/58 (40%)
COX7A1NP_001855.1 Cyt_c_Oxidase_VIIa 22..76 CDD:238468 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CUDK
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5465
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1548349at2759
OrthoFinder 1 1.000 - - FOG0001153
OrthoInspector 1 1.000 - - oto90149
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10510
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8442
SonicParanoid 1 1.000 - - X1656
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.