DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7A and Cox7a2

DIOPT Version :9

Sequence 1:NP_001246986.1 Gene:COX7A / 50002 FlyBaseID:FBgn0040529 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_034075.2 Gene:Cox7a2 / 12866 MGIID:1316715 Length:83 Species:Mus musculus


Alignment Length:85 Identity:30/85 - (35%)
Similarity:44/85 - (51%) Gaps:21/85 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RSFATTAGRRSAAVPKDQIEKGYFE--IRKVQEHFQKKDGKPVFLKGSVVDNVLYRVTVALALVG 81
            |:.:||:.|             :||  :.:.|:.||:.:|.||.|||...|.:|||.|:||.|  
Mouse    14 RTISTTSRR-------------HFENKVPEKQKLFQEDNGMPVHLKGGASDALLYRATMALTL-- 63

  Fly    82 IGGMGKLFYELSV---PKKE 98
             ||.....|.|::   |||:
Mouse    64 -GGTAYAIYLLAMAAFPKKQ 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7ANP_001246986.1 Cyt_c_Oxidase_VIIa 40..94 CDD:238468 23/55 (42%)
Cox7a2NP_034075.2 Cyt_c_Oxidase_VIIa 24..78 CDD:238468 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CUDK
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1548349at2759
OrthoFinder 1 1.000 - - FOG0001153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110740
Panther 1 1.100 - - LDO PTHR10510
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8442
SonicParanoid 1 1.000 - - X1656
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.