DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7A and cox7a2b

DIOPT Version :9

Sequence 1:NP_001246986.1 Gene:COX7A / 50002 FlyBaseID:FBgn0040529 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_001373306.1 Gene:cox7a2b / 100535363 ZFINID:ZDB-GENE-130514-2 Length:83 Species:Danio rerio


Alignment Length:83 Identity:30/83 - (36%)
Similarity:43/83 - (51%) Gaps:17/83 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RSFATTAGRRSAAVPKDQIEKGYFEIRKVQEHFQKKDGKPVFLKGSVVDNVLYRVTVALALVGIG 83
            |..::|..|..|....|:           |:.||:.:|.||.|||.|.|.||||.|::|.:|   
Zfish    14 RQISSTVRRHMANKVPDK-----------QKLFQEANGVPVHLKGGVGDAVLYRATMSLTVV--- 64

  Fly    84 GMGKLFYEL---SVPKKE 98
            |...:.|||   :||:|:
Zfish    65 GTVCVIYELLKAAVPQKK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7ANP_001246986.1 Cyt_c_Oxidase_VIIa 40..94 CDD:238468 22/56 (39%)
cox7a2bNP_001373306.1 Cyt_c_Oxidase_VIIa 26..78 CDD:238468 23/65 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1548349at2759
OrthoFinder 1 1.000 - - FOG0001153
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10510
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8442
SonicParanoid 1 1.000 - - X1656
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.