DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and AT1G20270

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:238 Identity:64/238 - (26%)
Similarity:107/238 - (44%) Gaps:50/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 NTTTTP-----FTRIAPLKMEELG-----------LDPYMVVFHDVIYDTEIDGMLN-------S 320
            |..::|     |.|.|..:.|.||           .:|...|:|:.:...|.:.:::       .
plant    46 NDESSPIDLSYFRRAATERSEGLGKRGDQWTEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVK 110

  Fly   321 SNFGLSLTDSGQKSEVRTSKDSYIVDA-----KTLNERVTDMTGFSMEMSDPFSLINYGLGGHYM 380
            |....|.|...:.|.||||..:::...     ||:.:|:.|.|....:..:...:::|..|..|.
plant   111 STVVDSETGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYE 175

  Fly   381 LHYD-FHEYTNTTRPKQGDRIATVLFYLGEVDSGGATIFPMIN-------------------ITV 425
            .||| |.:..||  ...|.|:||:|.||.:|:.||.|:||..|                   ::|
plant   176 PHYDYFVDEFNT--KNGGQRMATMLMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSV 238

  Fly   426 TPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKYVLTKWIN 468
            .|:.|.|:.::::.....::..|||..||||.|:|:..|||::
plant   239 KPRMGDALLFWSMRPDATLDPTSLHGGCPVIRGNKWSSTKWMH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 10/42 (24%)
P4Hc 313..467 CDD:214780 52/185 (28%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 56/205 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.