DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and AT5G66060

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:206 Identity:58/206 - (28%)
Similarity:94/206 - (45%) Gaps:32/206 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 MEELGLDPYMVVFHDVIYDTEIDGM-------LNSSNFGLSLTDSGQKSEVRTSKDSYIVDA--K 348
            :|.:..:|...|:|:.:...|...:       :..|......|.....|.||||..:::...  |
plant    78 VEIISWEPRASVYHNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLARGRDK 142

  Fly   349 TLNE---RVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQGDRIATVLFYLGEV 410
            |:.|   |::|.|...:|..:...:::|.:|..|..|||:......|| ..|.||||||.||.:|
plant   143 TIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTR-NGGQRIATVLMYLSDV 206

  Fly   411 DSGGATIFPMI-------------------NITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVI 456
            :.||.|:||..                   .::|.||.|.|:.::::.....::..|||..|.||
plant   207 EEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGCAVI 271

  Fly   457 SGSKYVLTKWI 467
            .|:|:..|||:
plant   272 KGNKWSSTKWL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 3/12 (25%)
P4Hc 313..467 CDD:214780 53/184 (29%)
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 58/206 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.