DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and AT5G18900

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 / 832008 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana


Alignment Length:225 Identity:68/225 - (30%)
Similarity:104/225 - (46%) Gaps:37/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 IAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLSLT-----DSGQK--SEVRTSKDSYIV 345
            :.|.|::::...|...|:...:.:.|.|.|::.:...|..:     |||:.  ||||||..::|.
plant    32 VNPSKVKQVSSKPRAFVYEGFLTELECDHMVSLAKASLKRSAVADNDSGESKFSEVRTSSGTFIS 96

  Fly   346 DAKT-----LNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYD-FHEYTNTTRPKQGDRIATVL 404
            ..|.     :.::::..|....|..:...::.|..|..|..|:| ||:..|..|  .|.|:||:|
plant    97 KGKDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDAHFDYFHDKVNIVR--GGHRMATIL 159

  Fly   405 FYLGEVDSGGATIFP---------------------MINITVTPKKGSAVFWYNLHNSGAMNLKS 448
            .||..|..||.|:||                     ...|.|.|:||.|:.::|||.....:..|
plant   160 MYLSNVTKGGETVFPDAEIPSRRVLSENKEDLSDCAKRGIAVKPRKGDALLFFNLHPDAIPDPLS 224

  Fly   449 LHSACPVISGSKYVLTKWIN-ELPQMFVTP 477
            ||..||||.|.|:..||||: :.....|||
plant   225 LHGGCPVIEGEKWSATKWIHVDSFDRIVTP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 4/17 (24%)
P4Hc 313..467 CDD:214780 59/187 (32%)
AT5G18900NP_197391.1 PLN00052 33..298 CDD:177683 68/224 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.