DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and AT4G35820

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:269 Identity:63/269 - (23%)
Similarity:113/269 - (42%) Gaps:58/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 QLTDAFYHFENKPEGIIASNEVIHFKEELSTKQNCAVVVQKPSRLHCRYNTTTTPFTRIA----- 289
            :.:|...|. |..:.::.....:..|.|..||....:....|     ...|.|....::|     
plant    24 ETSDLIQHI-NTFDELVGEQVSVDVKIEEKTKDMILLCSLSP-----LLTTLTCSMVKVAASLRF 82

  Fly   290 PLK--MEELGLDPYMVVFHDVI--------YDTEIDGMLN-------SSNFGLSLTDSGQKSEVR 337
            |.:  :|.:..:|...|:|:.:        .:.|.|.:::       .|....:||..|::|..|
plant    83 PNERWLEVITKEPRAFVYHNFLALFFKICKTNEECDHLISLAKPSMARSKVRNALTGLGEESSSR 147

  Fly   338 TSKDSYIVD-----AKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQG 397
            ||..::|..     .|.:.:|:::.|....|..:...:|||.:|..:..|:|..:          
plant   148 TSSGTFIRSGHDKIVKEIEKRISEFTFIPQENGETLQVINYEVGQKFEPHFDGFQ---------- 202

  Fly   398 DRIATVLFYLGEVDSGGATIFPMI-------NITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPV 455
             ||||||.||.:||.||.|:||..       .::|.||||.|:.::::...|:.:..|.|     
plant   203 -RIATVLMYLSDVDKGGETVFPEAKGIKSKKGVSVRPKKGDALLFWSMRPDGSRDPSSKH----- 261

  Fly   456 ISGSKYVLT 464
              |.::.|:
plant   262 --GKRHCLS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 14/75 (19%)
P4Hc 313..467 CDD:214780 47/171 (27%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 10/58 (17%)
P4Hc 115..262 CDD:214780 45/164 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.