DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and AT4G35810

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:210 Identity:58/210 - (27%)
Similarity:99/210 - (47%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 MEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLS-------LTDSGQKSEVRTSKDSY------- 343
            :|.:..:|...|:|:.:.:.|.:.:::.:...:.       .|.....|.||||..::       
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSIDSRVRTSSGTFLNRGHDE 144

  Fly   344 IVDAKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYD-FHEYTNTTRPKQGDRIATVLFYL 407
            ||:  .:..|::|.|....|..:...:::|.:|..|..|:| |.:..|..  |.|.||||||.||
plant   145 IVE--EIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFDEFNVR--KGGQRIATVLMYL 205

  Fly   408 GEVDSGGATIFPMI-------------------NITVTPKKGSAVFWYNLHNSGAMNLKSLHSAC 453
            .:||.||.|:||..                   .::|.|||..|:.::::....:::..|||..|
plant   206 SDVDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSSLHGGC 270

  Fly   454 PVISGSKYVLTKWIN 468
            |||.|:|:..|||.:
plant   271 PVIKGNKWSSTKWFH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 3/12 (25%)
P4Hc 313..467 CDD:214780 53/187 (28%)
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 58/210 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.