DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and AT4G33910

DIOPT Version :10

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:273 Identity:66/273 - (24%)
Similarity:99/273 - (36%) Gaps:92/273 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 PEGIIASNEV--------------IHFKEELSTKQNCAVVVQ------KPSRLHCRYNTT--TTP 284
            |.|:.....:              |:| ...:|.:.|..:::      |||.|..|...|  .|.
plant    64 PHGVTGEESIGSIPFQVLSWRPRAIYF-PNFATAEQCQAIIERAKVNLKPSALALRKGETAENTK 127

  Fly   285 FTRIAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLSLTDSG---QKSEVRTSKDSYIVD 346
            .||                                        |.||   ..||..|....::  
plant   128 GTR----------------------------------------TSSGTFISASEESTGALDFV-- 150

  Fly   347 AKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTR--PKQGDRIATVLFYLGE 409
                ..::...|.......:.|:::.|.||..|..|||..   |.|.  |:...|||:.|.||.:
plant   151 ----ERKIARATMIPRSHGESFNILRYELGQKYDSHYDVF---NPTEYGPQSSQRIASFLLYLSD 208

  Fly   410 VDSGGATIFPM---------------INITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGS 459
            |:.||.|:||.               |.:.|.|:||..:.:|::..:|.::..|||.:|||..|.
plant   209 VEEGGETMFPFENGSNMGIGYDYKQCIGLKVKPRKGDGLLFYSVFPNGTIDQTSLHGSCPVTKGE 273

  Fly   460 KYVLTKWINELPQ 472
            |:|.||||.:..|
plant   274 KWVATKWIRDQDQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..168 CDD:462433
P4Hc 313..467 CDD:214780 48/173 (28%)
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 65/271 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.