DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and AT3G28490

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:212 Identity:60/212 - (28%)
Similarity:95/212 - (44%) Gaps:32/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 IAPLKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNFGLSLT------DSGQK--SEVRTSKDSYI 344
            :.|.::.:|...|...::...:.|.|.|.::..:...|..:      |||:.  ||||||...::
plant    27 VDPTRITQLSWTPRAFLYKGFLSDEECDHLIKLAKGKLEKSMVVADVDSGESEDSEVRTSSGMFL 91

  Fly   345 VDAK-----TLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQGDRIATVL 404
            ...:     .:..::...|....|..:...:::|..|..|..|:|:. |........|.||||||
plant    92 TKRQDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYF-YDKKALELGGHRIATVL 155

  Fly   405 FYLGEVDSGGATIFP------------------MINITVTPKKGSAVFWYNLHNSGAMNLKSLHS 451
            .||..|..||.|:||                  .....|.|:||.|:.::|||.:|..:..|||.
plant   156 MYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFFNLHLNGTTDPNSLHG 220

  Fly   452 ACPVISGSKYVLTKWIN 468
            :||||.|.|:..|:||:
plant   221 SCPVIEGEKWSATRWIH 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 3/17 (18%)
P4Hc 313..467 CDD:214780 54/184 (29%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 60/211 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.