DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and p4htma

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001074160.1 Gene:p4htma / 791209 ZFINID:ZDB-GENE-070112-2222 Length:478 Species:Danio rerio


Alignment Length:163 Identity:46/163 - (28%)
Similarity:67/163 - (41%) Gaps:44/163 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 KTLNERVTDMTGFS---MEMSDPFSLINYGLGGHYMLHYD------------FHEYTNTTRPKQG 397
            |::..|||.:|...   :::|:...::.|..|.....|:|            .|...||:. :..
Zfish   283 KSVRNRVTRLTRLPSSLVDLSEAMEVVRYEQGVFSHAHHDSSPTHPDNSCTHTHLAANTSN-QVA 346

  Fly   398 DRIATVLFYLGEVDSGGATIFPMI---------------------NITVTPKKGSAVFWYNLHNS 441
            .|..|||.||...||||.|.||:.                     |:.|.|..|:|:.||| |.|
Zfish   347 CRYLTVLLYLNSADSGGETSFPVADNRTYEEEVLGDLSQQYCDKGNLKVKPVAGTALLWYN-HLS 410

  Fly   442 ------GAMNLKSLHSACPVISGSKYVLTKWIN 468
                  |.::..|||..|.|..|.|:..:.|:|
Zfish   411 DGNGWVGELDEFSLHGDCLVTRGFKWTGSVWVN 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200
P4Hc 313..467 CDD:214780 44/160 (28%)
p4htmaNP_001074160.1 2OG-FeII_Oxy <272..442 CDD:304390 44/160 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583481
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.