DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:218 Identity:50/218 - (22%)
Similarity:91/218 - (41%) Gaps:30/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 LKMEELGLDPYMVVFHDVIYDTEIDGMLNSSNF-----GLSLTDSGQK--SEVRTSKDSYIV--- 345
            :|:|.:...|.:|::.|:....::...|.....     .|.:.|.|..  |::|.:..:.:.   
 Worm    22 VKVEVVAWRPGLVIYRDLFTGKQVRDHLELMEHLKFEEQLVVNDDGNDIVSKIRRANGTQVFHED 86

  Fly   346 ---------DAKTLNERVTDMTGFSMEMSDPFSLINYGLGGHYMLHYDFHEYTNTTRPKQ----- 396
                     .||.|      :...:.:.::....::|..||||..|:|:..|.:.....:     
 Worm    87 HPAARSIWDTAKNL------LPNLNFKTAEDILALSYNPGGHYAAHHDYLLYPSEKEWDEWMRVN 145

  Fly   397 GDRIATVLFYLGEVDSGGATIFPMINITVTPKKGSAVFWYNLHNSGAMNLKSLHSACPVISGSKY 461
            |:|..|::...|..:|||||:||.:...|..|.|.|.||:|...:......|.|:.||:..|.|.
 Worm   146 GNRFGTLIMAFGAAESGGATVFPRLGAAVRTKPGDAFFWFNAMGNSEQEDLSEHAGCPIYKGQKQ 210

  Fly   462 VLTKWINELPQMFVTPCMKDSNL 484
            :.|.|:....|..:...:...:|
 Worm   211 ISTIWLRMRDQPILEQTLSSDSL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200 4/14 (29%)
P4Hc 313..467 CDD:214780 42/177 (24%)
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 43/179 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.