DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and P4HTM

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:287 Identity:65/287 - (22%)
Similarity:93/287 - (32%) Gaps:126/287 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 DTEIDGMLNSSNF-GLSLTD--------SGQKSE-VRTSKDSYIVDA-------KTLNERVTDMT 358
            |.:.||:|:...| .:.|.|        ..:.|| ||.|..:::...       :.:.:||..:|
Human   237 DPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLT 301

  Fly   359 GFS---MEMSDPFSLINYGLGGHYMLHYD----------------------FHEYTNTTRPK--- 395
            ..|   :|:|:|..::.||.||||..|.|                      |........|.   
Human   302 RLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGL 366

  Fly   396 -------------------------QGDR------------------------IATVLFYLGEVD 411
                                     .||.                        ..||||||..|.
Human   367 PSILRPGTPMTQAQPCTVGVPLGMGPGDHWVIPVSPWEHPQLGTCSVPPLPYSYMTVLFYLNNVT 431

  Fly   412 SGGATIFPMI---------------------------NITVTPKKGSAVFWYNLHNSGA-----M 444
            .||.|:||:.                           |:.|.|::|:||||||....|.     :
Human   432 GGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGDV 496

  Fly   445 NLKSLHSACPVISGSKYVLTKWINELP 471
            :..|||..|.|..|:|::...|||..|
Human   497 DDYSLHGGCLVTRGTKWIANNWINVDP 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200
P4Hc 313..467 CDD:214780 60/279 (22%)
P4HTMNP_808807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
EF-hand_7 192..252 CDD:290234 5/14 (36%)
EFh 194..252 CDD:238008 5/14 (36%)
P4Hc 246..519 CDD:214780 57/272 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149313
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.