Sequence 1: | NP_652183.2 | Gene: | CG15864 / 50001 | FlyBaseID: | FBgn0040528 | Length: | 490 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_217285.7 | Gene: | P4htm / 301008 | RGDID: | 1311848 | Length: | 503 | Species: | Rattus norvegicus |
Alignment Length: | 226 | Identity: | 65/226 - (28%) |
---|---|---|---|
Similarity: | 96/226 - (42%) | Gaps: | 65/226 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 311 DTEIDGMLNSSNF-GLSLTD--------SGQKSE-VRTSKDSYIVDA-------KTLNERVTDMT 358
Fly 359 GFS---MEMSDPFSLINYGLGGHYMLHYD----FHE--------YTNTTRP-KQGDRIATVLFYL 407
Fly 408 GEVDSGGATIFPMI---------------------------NITVTPKKGSAVFWYNLHNS---- 441
Fly 442 -GAMNLKSLHSACPVISGSKYVLTKWINELP 471 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15864 | NP_652183.2 | P4Ha_N | 35..166 | CDD:285528 | |
metallo-dependent_hydrolases | <237..>306 | CDD:294200 | |||
P4Hc | 313..467 | CDD:214780 | 60/218 (28%) | ||
P4htm | XP_217285.7 | EF-hand_7 | 193..253 | CDD:404394 | 5/14 (36%) |
P4Hc | 247..459 | CDD:214780 | 57/211 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166343188 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |