DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15864 and P4htm

DIOPT Version :9

Sequence 1:NP_652183.2 Gene:CG15864 / 50001 FlyBaseID:FBgn0040528 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:226 Identity:65/226 - (28%)
Similarity:96/226 - (42%) Gaps:65/226 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 DTEIDGMLNSSNF-GLSLTD--------SGQKSE-VRTSKDSYIVDA-------KTLNERVTDMT 358
            |.:.||:|:...| .:.|.|        ..:.|| ||.|..:::...       :.:.:||..:|
  Rat   238 DPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLHQGEGAHHVMRAIRQRVLRLT 302

  Fly   359 GFS---MEMSDPFSLINYGLGGHYMLHYD----FHE--------YTNTTRP-KQGDRIATVLFYL 407
            ..|   :|:|:|..::.||.||||..|.|    :.|        ..|.:.| :...|..||||||
  Rat   303 RLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETVCSHTKLVANESVPFETSCRYMTVLFYL 367

  Fly   408 GEVDSGGATIFPMI---------------------------NITVTPKKGSAVFWYNLHNS---- 441
            ..|..||.|:||:.                           |:.|.|::|:||||||....    
  Rat   368 NNVTGGGETVFPVADNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGW 432

  Fly   442 -GAMNLKSLHSACPVISGSKYVLTKWINELP 471
             |.::..|||..|.|..|:|::...|||..|
  Rat   433 VGEVDDYSLHGGCLVTRGTKWIANNWINVDP 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15864NP_652183.2 P4Ha_N 35..166 CDD:285528
metallo-dependent_hydrolases <237..>306 CDD:294200
P4Hc 313..467 CDD:214780 60/218 (28%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 5/14 (36%)
P4Hc 247..459 CDD:214780 57/211 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.