DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and ACYP2

DIOPT Version :9

Sequence 1:NP_001246977.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001307515.1 Gene:ACYP2 / 98 HGNCID:180 Length:172 Species:Homo sapiens


Alignment Length:101 Identity:44/101 - (43%)
Similarity:58/101 - (57%) Gaps:6/101 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SDEP---VFSCQFEVF---GIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFES 110
            |:||   ..||....|   .|...|.|||||...|:|:||.||.|||::.||.|::|.......|
Human    70 SEEPWKENISCSSTTFIKSTICLSVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNS 134

  Fly   111 MRLWLKHTGSPTSRIDKCIFSETTELSEFTFTNFSI 146
            |:.||...|||:||||:..||....:|:..::||||
Human   135 MKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11052NP_001246977.1 Acylphosphatase 56..146 CDD:279097 39/92 (42%)
ACYP2NP_001307515.1 Acylphosphatase 94..171 CDD:279097 37/77 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7581
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5759
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - mtm8538
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.