DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and ACYP1

DIOPT Version :9

Sequence 1:NP_001246977.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001289546.1 Gene:ACYP1 / 97 HGNCID:179 Length:129 Species:Homo sapiens


Alignment Length:92 Identity:36/92 - (39%)
Similarity:55/92 - (59%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESMRLWLKHTGS 120
            :.|..:|:||.||||.||.:|....:|||:.||.:||:..||:|::|........|:.||:..||
Human    37 LISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGS 101

  Fly   121 PTSRIDKCIFSETTELSEFTFTNFSIV 147
            |.|.|||..|:....:.:..:::|.||
Human   102 PKSHIDKANFNNEKVILKLDYSDFQIV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11052NP_001246977.1 Acylphosphatase 56..146 CDD:279097 34/89 (38%)
ACYP1NP_001289546.1 Acylphosphatase 40..127 CDD:376373 33/86 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159990
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - mtm8538
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.