DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and AT5G03370

DIOPT Version :9

Sequence 1:NP_001246977.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_195957.1 Gene:AT5G03370 / 831859 AraportID:AT5G03370 Length:171 Species:Arabidopsis thaliana


Alignment Length:133 Identity:33/133 - (24%)
Similarity:55/133 - (41%) Gaps:28/133 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RRRVTLPSSTP--DKGTPSKKGSEEPNRISNTEFQKRVTSDRSDEPVFSCQFEVFGIVQGVSFRM 74
            |..:.|.||.|  ...|.::.||.:.:..|.|   .||.              :.|.||||.:|.
plant    52 RPLIWLRSSPPVSSMTTQAESGSSQQSDSSKT---VRVV--------------IKGRVQGVCYRN 99

  Fly    75 YTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESMRLWLKHTGSPTSRIDKCIFSETTELSEF 139
            :|:..|::||::||.:|..:.:|:........:.:.|....:. |.|.:.:        |.|..|
plant   100 WTVENAEQLGIKGWVRNRRDGSVEALFSGPPEAVDEMHQRCRR-GPPAAMV--------TGLEAF 155

  Fly   140 TFT 142
            ..|
plant   156 PST 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11052NP_001246977.1 Acylphosphatase 56..146 CDD:279097 21/87 (24%)
AT5G03370NP_195957.1 Acylphosphatase 83..171 CDD:382074 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4519
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.