DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and CG34161

DIOPT Version :9

Sequence 1:NP_001246977.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001097143.1 Gene:CG34161 / 5740441 FlyBaseID:FBgn0085190 Length:125 Species:Drosophila melanogaster


Alignment Length:118 Identity:47/118 - (39%)
Similarity:68/118 - (57%) Gaps:0/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KKGSEEPNRISNTEFQKRVTSDRSDEPVFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTN 93
            ||......::..:..:.::....:...:|||||||||.||||.||.:|.::|.:||:.|||.||.
  Fly     6 KKSKTTTKKLVKSSPKAQLPKAAAQNQIFSCQFEVFGHVQGVFFRKHTQKKAIELGITGWCMNTT 70

  Fly    94 ENTVKGEIQAHRHSFESMRLWLKHTGSPTSRIDKCIFSETTELSEFTFTNFSI 146
            :.||:|.::........|:.||:|.|||.|.|:|.:|||...|....|..|||
  Fly    71 QGTVQGMLEGSLDQMTDMKYWLQHKGSPRSVIEKAVFSENEPLPINNFKMFSI 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11052NP_001246977.1 Acylphosphatase 56..146 CDD:279097 43/89 (48%)
CG34161NP_001097143.1 Acylphosphatase 35..124 CDD:279097 44/89 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471707
Domainoid 1 1.000 47 1.000 Domainoid score I4519
eggNOG 1 0.900 - - E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5343
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D145178at6656
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm26072
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - P PTHR10029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
1211.810

Return to query results.
Submit another query.