DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and acyp2

DIOPT Version :9

Sequence 1:NP_001246977.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001015794.1 Gene:acyp2 / 548511 XenbaseID:XB-GENE-944874 Length:103 Species:Xenopus tropicalis


Alignment Length:88 Identity:43/88 - (48%)
Similarity:57/88 - (64%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESMRLWLKHTGSPT 122
            |..:||||.||||.|||||...|:||||.||.|||.:.||.|::|.......||:.||...|||:
 Frog    13 SVDYEVFGRVQGVCFRMYTEDEARKLGVVGWVKNTRQGTVTGQVQGPEDKVNSMKAWLSRVGSPS 77

  Fly   123 SRIDKCIFSETTELSEFTFTNFS 145
            ||||:..|::..|:::..:..||
 Frog    78 SRIDRIDFNDEKEITKLQYNGFS 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11052NP_001246977.1 Acylphosphatase 56..146 CDD:279097 43/88 (49%)
acyp2NP_001015794.1 Acylphosphatase 14..100 CDD:376373 40/85 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7667
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - mtm9551
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.