DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and acyp2

DIOPT Version :9

Sequence 1:NP_001246977.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_005172988.1 Gene:acyp2 / 101886626 ZFINID:ZDB-GENE-130530-886 Length:87 Species:Danio rerio


Alignment Length:65 Identity:32/65 - (49%)
Similarity:41/65 - (63%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VTSDRSDEPVFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESM 111
            ::|:..|:.| |..|||||.||||.|||||....:||||.||.|||.:.||.|::|......:.|
Zfish    24 MSSEAGDKYV-SVDFEVFGNVQGVCFRMYTEAEGKKLGVTGWVKNTRQGTVVGQVQGPPEKVKEM 87

  Fly   112  111
            Zfish    88  87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11052NP_001246977.1 Acylphosphatase 56..146 CDD:279097 30/56 (54%)
acyp2XP_005172988.1 Acylphosphatase 33..>87 CDD:279097 29/54 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9904
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5343
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm26072
orthoMCL 1 0.900 - - OOG6_101060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.