powered by:
Protein Alignment CG11052 and acyp2
DIOPT Version :9
Sequence 1: | NP_001246977.1 |
Gene: | CG11052 / 49997 |
FlyBaseID: | FBgn0040524 |
Length: | 149 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005172988.1 |
Gene: | acyp2 / 101886626 |
ZFINID: | ZDB-GENE-130530-886 |
Length: | 87 |
Species: | Danio rerio |
Alignment Length: | 65 |
Identity: | 32/65 - (49%) |
Similarity: | 41/65 - (63%) |
Gaps: | 1/65 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 VTSDRSDEPVFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESM 111
::|:..|:.| |..|||||.||||.|||||....:||||.||.|||.:.||.|::|......:.|
Zfish 24 MSSEAGDKYV-SVDFEVFGNVQGVCFRMYTEAEGKKLGVTGWVKNTRQGTVVGQVQGPPEKVKEM 87
Fly 112 111
Zfish 88 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
66 |
1.000 |
Domainoid score |
I9904 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3360 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
67 |
1.000 |
Inparanoid score |
I5343 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1502266at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001379 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm26072 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101060 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1110 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.770 |
|
Return to query results.
Submit another query.