DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11052 and LOC101733443

DIOPT Version :9

Sequence 1:NP_001246977.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_004913753.1 Gene:LOC101733443 / 101733443 -ID:- Length:98 Species:Xenopus tropicalis


Alignment Length:93 Identity:38/93 - (40%)
Similarity:57/93 - (61%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SDEPVFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESMRLWLK 116
            |...::|..:|::|.||||.||.||..:|:::...||.||....||.|::|..:...|.|:.||:
 Frog     2 SSTGLWSVDYEIYGDVQGVFFRKYTEDQAKRVSAVGWVKNAPHGTVIGQVQGSKSIVEIMKNWLQ 66

  Fly   117 HTGSPTSRIDKCIFSETTELSEFTFTNF 144
            :.|||.|||||.:||...|:....:|:|
 Frog    67 NVGSPMSRIDKAVFSNEHEIQALEYTSF 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11052NP_001246977.1 Acylphosphatase 56..146 CDD:279097 37/89 (42%)
LOC101733443XP_004913753.1 Acylphosphatase 9..94 CDD:376373 35/84 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7667
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - mtm9551
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.