DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCS2alpha and D2096.12

DIOPT Version :9

Sequence 1:NP_652145.1 Gene:GCS2alpha / 49953 FlyBaseID:FBgn0027588 Length:924 Species:Drosophila melanogaster
Sequence 2:NP_001023103.1 Gene:D2096.12 / 3565193 WormBaseID:WBGene00017079 Length:763 Species:Caenorhabditis elegans


Alignment Length:214 Identity:40/214 - (18%)
Similarity:66/214 - (30%) Gaps:78/214 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   634 TELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELT 698
            :|::|:.:|........|:...:..::||.|      :..|.:                 ||...
 Worm   593 SEIVEQEFQKRLAEIEQRSLEQVRNEKREQW------KSKIMD-----------------ELTEK 634

  Fly   699 GEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVD- 762
            ||     |||.:.|..:....|:.:..:|.                     ||:   ||||... 
 Worm   635 GE-----LLAFFELTSDGGRNDDYIWTEDE---------------------DDE---DWWYPTPY 670

  Fly   763 -------------TYQRQERSGYVSVPVDDFKIPVWQRGGSIVPKKERQRRASTLMLHDPYTLII 814
                         ..|||.|...........|:...:..|  :.|:|..|..|          ::
 Worm   671 NHPKSTLCSQCAFRQQRQRRIAKREREQAKIKVSCLKEYG--IEKRESLRNMS----------VL 723

  Fly   815 CLDRQGKASGSLYLDDEKS 833
            ...|...|..||:.::|.|
 Worm   724 TKSRIEAADKSLFRENEVS 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCS2alphaNP_652145.1 GH31_N 224..362 CDD:270212
Glyco_hydro_31 343..792 CDD:279404 30/171 (18%)
GH31_GANC_GANAB_alpha 362..833 CDD:269889 39/212 (18%)
D2096.12NP_001023103.1 MCU 216..>284 CDD:309702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.