DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17450 and Tekt4

DIOPT Version :9

Sequence 1:NP_728438.2 Gene:CG17450 / 49952 FlyBaseID:FBgn0040028 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001013987.1 Gene:Tekt4 / 302991 RGDID:1308075 Length:447 Species:Rattus norvegicus


Alignment Length:468 Identity:150/468 - (32%)
Similarity:238/468 - (50%) Gaps:51/468 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 TKHPWRPAMAYELIQVKHMPEQPVTNQLTKQCFLPKGMKTDGMIFPNLVTGFDRNPQHAARAALY 204
            ||.|     |.:.|.|..:|::..........:...|:.|.|.                 |.|  
  Rat     9 TKEP-----APQSIDVCELPQKKYEVACNTGAYTSAGLATAGF-----------------RTA-- 49

  Fly   205 TRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFW 269
             :|..:||:.|:..:|.::..:|:.|||.|:::.:|..||.|.|...|.|:.||:|||:.|:..|
  Rat    50 -KYLMDEWFQNSYARYHQAFADRDYSERQRHESKQLAAETGELAYRTQLDSTRRVGERLEDMHCW 113

  Fly   270 RNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLV 334
            ::||..|:::|.:|...:...:.:..:||..|.:|..||.:.|..||.||..:.|.|.||..||.
  Rat   114 KSELQREIDELSSETDQMMAQKLRLQRALDALSVPFSIATDNLQCRERRQHPDLVRDYVEVELLK 178

  Fly   335 EINNLRNSRD-------------RLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQ 386
            |...:||.::             ||...|::      :|       |.:.|.|.....||..|.:
  Rat   179 ETELIRNIQELLKRTMGQAVGQIRLNREHKE------NC-------EINWSDKVEVYNIDDTCAR 230

  Fly   387 LNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWD 451
            ..|.|..:.:|....||:.|.||.|:|.:.:.:.:.|::.||.....||.....::...|..:..
  Rat   231 YTNESTQVQFYPHSSKFEESASTPETWGKFTQDVLLRAERERLASVNLRKLIDCILRDTAEDLRL 295

  Fly   452 FWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEAR 516
            .....|.||..|.:|:.:|:.::|.||.|:..|:.|.|..:..|::||:||..||:||||||..|
  Rat   296 QCDAVNLAFSNRCEELNDARQKLQYHLLKILSEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQR 360

  Fly   517 SHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFI 581
            |||..||||:|:||.||:.||:::..:::.|..||.:||...:.|..:|.:||.|:..|.|:|||
  Rat   361 SHRPNVELCRDNAQFRLMSEVEELNMSLKVLKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFI 425

  Fly   582 DREKCMSLRRSFP 594
            ||:|||:.|..:|
  Rat   426 DRQKCMTHRNRYP 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17450NP_728438.2 Tektin 212..591 CDD:281184 134/391 (34%)
Tekt4NP_001013987.1 Tektin 56..434 CDD:281184 134/390 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264325at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.