DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17450 and TEKT4

DIOPT Version :9

Sequence 1:NP_728438.2 Gene:CG17450 / 49952 FlyBaseID:FBgn0040028 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_011508972.1 Gene:TEKT4 / 150483 HGNCID:31012 Length:476 Species:Homo sapiens


Alignment Length:432 Identity:132/432 - (30%)
Similarity:217/432 - (50%) Gaps:43/432 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 TRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFW 269
            ::|...||:.|...:|.::..:|:.|||.|:::.:|..||...|...|:|:.|.:|||:.|...|
Human    37 SKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSW 101

  Fly   270 RNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLV 334
            ::||..|:|.|.||.:.:...:::..:||...|:|..|..:.|..||.|:....|.|.||..||.
Human   102 KSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLK 166

  Fly   335 EINNLRNSRDRL-GGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYG 398
            |...:||.::.| ..:.:.:|:..|: |..:...|.|.|.|..:..||..|.:.::.|..:..:.
Human   167 EAELIRNIQELLKRTIMQAVSQIRLN-REHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHP 230

  Fly   399 GIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRR 463
            ....|..|.||.|:.|:.:.:::.|:|.||...:.||.....::...:..:.......|.||.||
Human   231 YSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRR 295

  Fly   464 SQEMAEAKNRVQLHLQK-----------------------------------------VQQELFD 487
            .:|:.:|:.::..||.|                                         ..:|:.|
Human   296 CEELEDARYKLHHHLHKGHWSGLPSGHSPKTWVGPAWSRRSIYPGMGAQAQGELSCLQTLREITD 360

  Fly   488 MEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLM 552
            .|.::..|::||:||..||.||||||..||||..:|||:|.||.||:.||:::..::..|..||:
Human   361 QEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSLTALREKLL 425

  Fly   553 EAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFP 594
            |||.:.:.|.....:||.|:....|:|||||:|||:.|..:|
Human   426 EAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHRTRYP 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17450NP_728438.2 Tektin 212..591 CDD:281184 128/420 (30%)
TEKT4XP_011508972.1 Tektin 44..464 CDD:281184 128/420 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264325at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3872
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.