DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sumo3 and smt3

DIOPT Version :9

Sequence 1:NP_001019466.1 Gene:Sumo3 / 499417 RGDID:1561022 Length:110 Species:Rattus norvegicus
Sequence 2:NP_001303312.1 Gene:smt3 / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster


Alignment Length:92 Identity:66/92 - (71%)
Similarity:76/92 - (82%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQP 65
            ||:|| |.|   |.:||||||.|||.:|||||||:||||.|||.|||:|.||||:.:||||||||
  Fly     1 MSDEK-KGG---ETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQP 61

  Rat    66 INETDTPAQLEMEDEDTIDVFQQQTGG 92
            |||.|||..||||:.|||:|:||||||
  Fly    62 INENDTPTSLEMEEGDTIEVYQQQTGG 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sumo3NP_001019466.1 Ubl_SUMO2_3_4 16..87 CDD:340532 53/70 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..110 4/4 (100%)
smt3NP_001303312.1 Ubl_SUMO2_3_4 12..83 CDD:340532 53/70 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341317
Domainoid 1 1.000 112 1.000 Domainoid score I6042
eggNOG 1 0.900 - - E1_COG5227
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38251
Inparanoid 1 1.050 133 1.000 Inparanoid score I4499
OMA 1 1.010 - - QHG54171
OrthoDB 1 1.010 - - D1583700at2759
OrthoFinder 1 1.000 - - FOG0000413
OrthoInspector 1 1.000 - - otm46452
orthoMCL 1 0.900 - - OOG6_100654
Panther 1 1.100 - - LDO PTHR10562
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X327
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.