DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Marf1 and AT3G61028

DIOPT Version :10

Sequence 1:NP_724394.2 Gene:Marf1 / 49895 FlyBaseID:FBgn0039972 Length:1305 Species:Drosophila melanogaster
Sequence 2:NP_001190148.1 Gene:AT3G61028 / 5008101 AraportID:AT3G61028 Length:254 Species:Arabidopsis thaliana


Alignment Length:161 Identity:35/161 - (21%)
Similarity:64/161 - (39%) Gaps:30/161 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PYQQLSTL----------SPTTALYSNFNNSLEAGTAERLRLNKTGSQVHSLYVGDGQVQNASEP 95
            ||:.:..|          .|.|:: :.|.|:........|.|:.||  |::.::.||:.::|.:.
plant    99 PYRLVGNLRKSLNEKGYRGPITSI-NAFGNTNRIDETTMLALSATG--VYTRHIPDGRKESAHKK 160

  Fly    96 LSFPSHLNLYQYVRTPAN-FTINSRNRYIPYYNNRSYSAS--------TTGFPIASTPLISSHAH 151
            :...........::.|.| ..|::|....|..:...|..|        :|..||..  ..||..|
plant   161 ILVDLLCFGMDNIQQPCNIMLISARPGCSPKMHVCGYQISHLCDRFYDSTNMPILG--FTSSPRH 223

  Fly   152 IQDQQGAASYQ--TIVPLYQTASHCAQQHTT 180
                :.::.|:  |..|.:.|..|.:.:|.|
plant   224 ----RWSSIYESFTSSPHFITTDHVSWRHGT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Marf1NP_724394.2 RRM2_LKAP 253..337 CDD:409701
MARF1_LOTUS 341..520 CDD:437519
LabA_like_C 560..631 CDD:472713
LabA_like_C 636..710 CDD:472713
LabA_like_C 723..794 CDD:472713
LOTUS 805..872 CDD:193585
AT3G61028NP_001190148.1 PIN_limkain_b1_N_like 81..>183 CDD:350234 17/86 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.