DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17508 and NAT2

DIOPT Version :9

Sequence 1:NP_652101.2 Gene:CG17508 / 49893 FlyBaseID:FBgn0039970 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_011663.3 Gene:NAT2 / 853050 SGDID:S000003379 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:31/168 - (18%)
Similarity:64/168 - (38%) Gaps:49/168 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 NRRYYSTQ---SPMQNSSTKTPTGAKLSKSEQLKRAFKEYGAPIVAFHVGISLISLAGFYVLVSS 251
            :|::|||:   |....:.:|:..|.| ::...:|....:||...:..::.::.:.|...::.|.|
Yeast    62 DRKFYSTEEKSSQFDENKSKSNNGKK-NEPHGIKGLMAKYGYSALIVYILLTCVDLPLCFLGVHS 125

  Fly   252 ------GINLVPALECIGIASP---AIVEKV--------------------ATGSTF-------- 279
                  .|.|....:.||:..|   .:::.|                    |:..||        
Yeast   126 LGEEKIKIYLNRGKQLIGMGEPDESKVIQDVRRKQAHREAVQAENADKVEDASRKTFNERWQEMK 190

  Fly   280 --------VVAYAVHKVFAPARISITLGSVPFVVRYIR 309
                    ::||.:||.....|:.:|....|..|:.::
Yeast   191 DSTLLAELLIAYGIHKSLIIVRVPLTAVLTPSFVKLLQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17508NP_652101.2 ALDH-SF <113..160 CDD:299846
DUF1279 217..303 CDD:284361 21/130 (16%)
NAT2NP_011663.3 DUF1279 93..221 CDD:369134 21/127 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344824
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.