DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17508 and AT2G27290

DIOPT Version :9

Sequence 1:NP_652101.2 Gene:CG17508 / 49893 FlyBaseID:FBgn0039970 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_565645.1 Gene:AT2G27290 / 817272 AraportID:AT2G27290 Length:201 Species:Arabidopsis thaliana


Alignment Length:123 Identity:41/123 - (33%)
Similarity:64/123 - (52%) Gaps:12/123 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 STKTPTGA------KLSKSEQLKRAFKEYGAPIVAFHVGISLISLAGFYVLVSSGINLVPALECI 262
            |:|...|:      |.||:::.|....:||...:|..:.:||||.:..||||:||:::...|..:
plant    82 SSKDDEGSDGDNKKKKSKTDEAKELLAKYGGAYLATSITLSLISFSLCYVLVTSGVDVQALLLKV 146

  Fly   263 GIASPAIVEKVATGSTFVVAYAVHKVFAPARISITLGSVPFVVRYIRSKKSQIPKPKN 320
            ||::....|||   ..|.:|||.||..:|.|...|:...|.|..:|..|   :.|.|:
plant   147 GISTNETGEKV---GAFALAYAAHKAASPIRFPPTVALTPIVANWIGKK---VDKEKD 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17508NP_652101.2 ALDH-SF <113..160 CDD:299846
DUF1279 217..303 CDD:284361 29/85 (34%)
AT2G27290NP_565645.1 DUF1279 103..184 CDD:369134 29/83 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004761
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103781
Panther 1 1.100 - - O PTHR21377
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.