DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17508 and fam210b

DIOPT Version :9

Sequence 1:NP_652101.2 Gene:CG17508 / 49893 FlyBaseID:FBgn0039970 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001028923.1 Gene:fam210b / 619270 ZFINID:ZDB-GENE-050913-122 Length:223 Species:Danio rerio


Alignment Length:108 Identity:53/108 - (49%)
Similarity:75/108 - (69%) Gaps:1/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 SSTKTPTGAKLSKSEQLKRAFKEYGAPIVAFHVGISLISLAGFYVLVSSGINLVPALECIGIASP 267
            ||....:..|.||.:||::.|::|||..|:||:.||||||..||:.||||:::...|..:|.:..
Zfish   104 SSAADGSELKASKVQQLRQVFQQYGAVGVSFHICISLISLGIFYLAVSSGLDVASLLCKLGFSEA 168

  Fly   268 AIVEKVATG-STFVVAYAVHKVFAPARISITLGSVPFVVRYIR 309
            .:..::|.| |.||:||||||:|||.||||||..||.:||::|
Zfish   169 VVQSRLAAGTSVFVLAYAVHKLFAPLRISITLVCVPLIVRHLR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17508NP_652101.2 ALDH-SF <113..160 CDD:299846
DUF1279 217..303 CDD:284361 44/86 (51%)
fam210bNP_001028923.1 DUF1279 118..205 CDD:284361 44/86 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587029
Domainoid 1 1.000 86 1.000 Domainoid score I8052
eggNOG 1 0.900 - - E1_KOG4526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383176at33208
OrthoFinder 1 1.000 - - FOG0004761
OrthoInspector 1 1.000 - - otm24340
orthoMCL 1 0.900 - - OOG6_103781
Panther 1 1.100 - - O PTHR21377
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4449
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.710

Return to query results.
Submit another query.