DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17508 and CG15403

DIOPT Version :9

Sequence 1:NP_652101.2 Gene:CG17508 / 49893 FlyBaseID:FBgn0039970 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_608749.2 Gene:CG15403 / 33527 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster


Alignment Length:175 Identity:95/175 - (54%)
Similarity:118/175 - (67%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 QEFKFTAQNMQCSHYSGLRESLRADWATYDQNATLKTNDQGLFNRRYYSTQSPMQNSSTKTPTGA 211
            :|:|:::|:|..:.:.|          .:.||               |||:|    :||.|.|..
  Fly    57 REYKYSSQDMNWTKHGG----------CFKQN---------------YSTES----ASTGTATTL 92

  Fly   212 KLSKSEQLKRAFKEYGAPIVAFHVGISLISLAGFYVLVSSGINLVPALECIGIASPAIVEKVATG 276
            |::|.||||||||||||.||.|||.||:|||.|||.||||||||||.||..|:.|.|:.||||.|
  Fly    93 KITKREQLKRAFKEYGATIVVFHVVISVISLGGFYALVSSGINLVPVLEYFGMGSSAVAEKVAAG 157

  Fly   277 STFVVAYAVHKVFAPARISITLGSVPFVVRYIRSKKSQIPKPKNT 321
            ||||||:||||:|||||||||||:.||:|||:|||  .:.|||:|
  Fly   158 STFVVAFAVHKIFAPARISITLGTTPFIVRYLRSK--GLLKPKST 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17508NP_652101.2 ALDH-SF <113..160 CDD:299846 4/12 (33%)
DUF1279 217..303 CDD:284361 66/85 (78%)
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 66/85 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457064
Domainoid 1 1.000 86 1.000 Domainoid score I8052
eggNOG 1 0.900 - - E1_KOG4526
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004761
OrthoInspector 1 1.000 - - otm24340
orthoMCL 1 0.900 - - OOG6_103781
Panther 1 1.100 - - P PTHR21377
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4449
98.740

Return to query results.
Submit another query.