DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17508 and Fam210b

DIOPT Version :9

Sequence 1:NP_652101.2 Gene:CG17508 / 49893 FlyBaseID:FBgn0039970 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001100017.1 Gene:Fam210b / 296408 RGDID:1311378 Length:190 Species:Rattus norvegicus


Alignment Length:118 Identity:67/118 - (56%)
Similarity:84/118 - (71%) Gaps:4/118 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QSPMQNS---STKTPTGAKLSKSEQLKRAFKEYGAPIVAFHVGISLISLAGFYVLVSSGINLVPA 258
            |:|.:.:   |..|.|..|||||:|||:.|:||||..|:.|:||||:||..||.:|||||::...
  Rat    62 QAPNRTTDPGSGATSTEKKLSKSQQLKKVFQEYGAVGVSLHIGISLVSLGIFYTIVSSGIDMSAI 126

  Fly   259 LECIGIASPAIVEKVATG-STFVVAYAVHKVFAPARISITLGSVPFVVRYIRS 310
            |..:|.....:..|:|.| |||||||||||:|||.||||||.||||:|||.||
  Rat   127 LLKLGFKESLVQSKMAAGTSTFVVAYAVHKLFAPVRISITLVSVPFLVRYFRS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17508NP_652101.2 ALDH-SF <113..160 CDD:299846
DUF1279 217..303 CDD:284361 50/86 (58%)
Fam210bNP_001100017.1 DUF1279 85..172 CDD:284361 50/86 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346072
Domainoid 1 1.000 97 1.000 Domainoid score I7077
eggNOG 1 0.900 - - E1_KOG4526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004761
OrthoInspector 1 1.000 - - otm45086
orthoMCL 1 0.900 - - OOG6_103781
Panther 1 1.100 - - O PTHR21377
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4449
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.700

Return to query results.
Submit another query.