DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fis1 and FIS1

DIOPT Version :9

Sequence 1:NP_001137607.1 Gene:Fis1 / 49892 FlyBaseID:FBgn0039969 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_012199.3 Gene:FIS1 / 854745 SGDID:S000001327 Length:155 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:47/147 - (31%)
Similarity:79/147 - (53%) Gaps:13/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ERFEKKYHHELEL-------DG--EVTTDTKFEYAFCLVRSRYTNDVRKGIMILEELARTHPDGR 70
            :.:|..|..:||:       :|  ..|..::|.||:.|::|...||.|.|:.||.::.:.....|
Yeast    12 DAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRR 76

  Fly    71 RDYIYYLAFGNARIKEYTSGLKYCRAFLDIE-SNDQVRSLEEYIKKEIDKEVAKGMVVAGGAALV 134
            |:.:|||..|..::.||:...:|.....:.| :|.||.:|:..::.:|.||..||:|||||   |
Yeast    77 RECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETLKGVVVAGG---V 138

  Fly   135 LGGILGLGIAMARNKQK 151
            |.|.:.:.....|||::
Yeast   139 LAGAVAVASFFLRNKRR 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fis1NP_001137607.1 Fis1 9..120 CDD:276936 32/114 (28%)
TPR repeat 33..65 CDD:276936 11/31 (35%)
TPR repeat 69..100 CDD:276936 9/30 (30%)
FIS1NP_012199.3 Fis1 16..129 CDD:276936 33/112 (29%)
TPR repeat 39..71 CDD:276936 11/31 (35%)
TPR repeat 75..106 CDD:276936 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346314
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3364
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1650
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58557
OrthoFinder 1 1.000 - - FOG0003777
OrthoInspector 1 1.000 - - oto99186
orthoMCL 1 0.900 - - OOG6_102996
Panther 1 1.100 - - LDO PTHR13247
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R448
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.