DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fis1 and BIGYIN

DIOPT Version :9

Sequence 1:NP_001137607.1 Gene:Fis1 / 49892 FlyBaseID:FBgn0039969 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001327069.1 Gene:BIGYIN / 824876 AraportID:AT3G57090 Length:170 Species:Arabidopsis thaliana


Alignment Length:151 Identity:42/151 - (27%)
Similarity:68/151 - (45%) Gaps:35/151 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGEV---------------TTDTKFE----YAFCLVRSRYTNDVRKGIMILEELARTH--PDGRR 71
            ||:|               |.|.|.|    .::.||.||.|.||::||.:||....:.  |...|
plant    26 DGDVIAGCEREVREATDSGTEDLKKECLMRLSWALVHSRQTEDVQRGIAMLEASLESSAPPLEDR 90

  Fly    72 DYIYYLAFGNARIKEYTSGLKYCRAFLDIESNDQVRSLEEYIKKEIDKEVAKGMVVA-------- 128
            :.:|.||.|..|...|:...:.....::::: |..::|  .:||.|:.::.|..|:.        
plant    91 EKLYLLAVGYYRSGNYSRSRQLVDRCIEMQA-DWRQAL--VLKKTIEDKITKDGVIGIGITATAF 152

  Fly   129 GGAALVLGGILGLGIAMARNK 149
            |...|:.|||:.   ||:|.|
plant   153 GAVGLIAGGIVA---AMSRKK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fis1NP_001137607.1 Fis1 9..120 CDD:276936 31/112 (28%)
TPR repeat 33..65 CDD:276936 14/35 (40%)
TPR repeat 69..100 CDD:276936 7/30 (23%)
BIGYINNP_001327069.1 Fis1 23..141 CDD:276936 32/117 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3364
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595957at2759
OrthoFinder 1 1.000 - - FOG0003777
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102996
Panther 1 1.100 - - LDO PTHR13247
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.