DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fis1 and Fis1

DIOPT Version :9

Sequence 1:NP_001137607.1 Gene:Fis1 / 49892 FlyBaseID:FBgn0039969 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_079838.1 Gene:Fis1 / 66437 MGIID:1913687 Length:152 Species:Mus musculus


Alignment Length:155 Identity:73/155 - (47%)
Similarity:103/155 - (66%) Gaps:10/155 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDLLNEVVPQEDLERFEKKYHHELELDGEVTTDTKFEYAFCLVRSRYTNDVRKGIMILEELART 65
            ||.:|||:|..|||:.||:|:..| :..|.|:..|:||||:|||||:|..|:|:||::||||.  
Mouse     1 MEAVLNELVSVEDLKNFERKFQSE-QAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEELL-- 62

  Fly    66 HPDG----RRDYIYYLAFGNARIKEYTSGLKYCRAFLDIE-SNDQVRSLEEYIKKEIDKEVAKGM 125
             |.|    :|||::|||.||.|:|||...|||.|..|..| .|:|.:.||..|.|.:.|:...||
Mouse    63 -PKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGM 126

  Fly   126 VVAGGAALVLGGILGL-GIAMARNK 149
            .:.||.||.:.|:.|| |:|::::|
Mouse   127 AIVGGMALGVAGLAGLIGLAVSKSK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fis1NP_001137607.1 Fis1 9..120 CDD:276936 55/115 (48%)
TPR repeat 33..65 CDD:276936 19/31 (61%)
TPR repeat 69..100 CDD:276936 18/34 (53%)
Fis1NP_079838.1 Fis1 9..123 CDD:276936 56/118 (47%)
TPR repeat 32..65 CDD:276936 19/32 (59%)
TPR repeat 69..100 CDD:276936 18/34 (53%)
TPR 71..104 18/33 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849665
Domainoid 1 1.000 52 1.000 Domainoid score I11454
eggNOG 1 0.900 - - E1_KOG3364
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41099
Inparanoid 1 1.050 134 1.000 Inparanoid score I4571
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58557
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003777
OrthoInspector 1 1.000 - - oto92474
orthoMCL 1 0.900 - - OOG6_102996
Panther 1 1.100 - - LDO PTHR13247
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R448
SonicParanoid 1 1.000 - - X6325
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.