DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fis1 and FIS1

DIOPT Version :9

Sequence 1:NP_001137607.1 Gene:Fis1 / 49892 FlyBaseID:FBgn0039969 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_057152.2 Gene:FIS1 / 51024 HGNCID:21689 Length:152 Species:Homo sapiens


Alignment Length:155 Identity:75/155 - (48%)
Similarity:104/155 - (67%) Gaps:10/155 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDLLNEVVPQEDLERFEKKYHHELELDGEVTTDTKFEYAFCLVRSRYTNDVRKGIMILEELART 65
            ||.:|||:|..|||.:||||:..| :..|.|:..|:||||:|||||:|.:|:||||::||||.  
Human     1 MEAVLNELVSVEDLLKFEKKFQSE-KAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELL-- 62

  Fly    66 HPDG----RRDYIYYLAFGNARIKEYTSGLKYCRAFLDIE-SNDQVRSLEEYIKKEIDKEVAKGM 125
             |.|    :|||::|||.||.|:|||...|||.|..|..| .|:|.:.||..|.|.:.|:...||
Human    63 -PKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGM 126

  Fly   126 VVAGGAALVLGGILGL-GIAMARNK 149
            .:.||.||.:.|:.|| |:|::::|
Human   127 AIVGGMALGVAGLAGLIGLAVSKSK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fis1NP_001137607.1 Fis1 9..120 CDD:276936 57/115 (50%)
TPR repeat 33..65 CDD:276936 20/31 (65%)
TPR repeat 69..100 CDD:276936 18/34 (53%)
FIS1NP_057152.2 Fis1 9..123 CDD:276936 58/117 (50%)
TPR 71..104 18/32 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159295
Domainoid 1 1.000 52 1.000 Domainoid score I11562
eggNOG 1 0.900 - - E1_KOG3364
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41099
Inparanoid 1 1.050 136 1.000 Inparanoid score I4576
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58557
OrthoDB 1 1.010 - - D1595957at2759
OrthoFinder 1 1.000 - - FOG0003777
OrthoInspector 1 1.000 - - oto88907
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13247
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R448
SonicParanoid 1 1.000 - - X6325
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.