DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fis1 and Fis1

DIOPT Version :9

Sequence 1:NP_001137607.1 Gene:Fis1 / 49892 FlyBaseID:FBgn0039969 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_006249183.1 Gene:Fis1 / 288584 RGDID:1306668 Length:186 Species:Rattus norvegicus


Alignment Length:129 Identity:63/129 - (48%)
Similarity:86/129 - (66%) Gaps:13/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDLLNEVVPQEDLERFEKKYHHELELDGEVTTDTKFEYAFCLVRSRYTNDVRKGIMILEELART 65
            ||.:|||:|..|||:.||:|:..| :..|.|:..|:||||:|||||:|.:|:|:||::||||.  
  Rat     1 MEAVLNELVSVEDLKNFERKFQSE-QAAGSVSKSTQFEYAWCLVRSKYNDDIRRGIVLLEELL-- 62

  Fly    66 HPDG----RRDYIYYLAFGNARIKEYTSGLKYCRAFLDIE-SNDQVRSLEEYIKKEIDKEVAKG 124
             |.|    :|||::|||.||.|:|||...|||.|..|..| .|:|.:.||    :.|||.:.||
  Rat    63 -PKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELE----RLIDKAMKKG 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fis1NP_001137607.1 Fis1 9..120 CDD:276936 55/115 (48%)
TPR repeat 33..65 CDD:276936 19/31 (61%)
TPR repeat 69..100 CDD:276936 18/34 (53%)
Fis1XP_006249183.1 Fis1 9..120 CDD:276936 55/115 (48%)
TPR repeat 32..65 CDD:276936 19/32 (59%)
TPR repeat 69..100 CDD:276936 18/34 (53%)
GH43_62_32_68 <125..161 CDD:301328 63/129 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353321
Domainoid 1 1.000 52 1.000 Domainoid score I11245
eggNOG 1 0.900 - - E1_KOG3364
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41099
Inparanoid 1 1.050 134 1.000 Inparanoid score I4494
OMA 1 1.010 - - QHG58557
OrthoDB 1 1.010 - - D1595957at2759
OrthoFinder 1 1.000 - - FOG0003777
OrthoInspector 1 1.000 - - oto96039
orthoMCL 1 0.900 - - OOG6_102996
Panther 1 1.100 - - LDO PTHR13247
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6325
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.