DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fis1 and fis-2

DIOPT Version :9

Sequence 1:NP_001137607.1 Gene:Fis1 / 49892 FlyBaseID:FBgn0039969 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001024560.1 Gene:fis-2 / 184409 WormBaseID:WBGene00001425 Length:151 Species:Caenorhabditis elegans


Alignment Length:150 Identity:48/150 - (32%)
Similarity:81/150 - (54%) Gaps:9/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDLLNEVVPQEDLERFEKKYHHELELDGEVTTDTKFEYAFCLVRSRYTNDVRKGIMILEELART 65
            :|:..|..|.....|::.::...     |:.:..:.|.:|..::.|:...||::||:.||:|.|.
 Worm     7 LEERTNPAVLMNAREQYMRQCAR-----GDPSAASTFAFAHAMIGSKNKLDVKEGIVCLEKLLRD 66

  Fly    66 HPD--GRRDYIYYLAFGNARIKEYTSGLKYCRAFLDIE-SNDQVRSLEEYIKKEIDKEVAKGMVV 127
            ..|  .:|:|:||||..:||||:|...|.|....||.| .|.|.::|:|.||..:..:...|..:
 Worm    67 DEDRTSKRNYVYYLAVAHARIKQYDLALGYIDVLLDAEGDNQQAKTLKESIKSAMTHDGLIGAAI 131

  Fly   128 AGGAALVLGGILGLGIAMAR 147
            .||.||.|.|::.: .:|:|
 Worm   132 VGGGALALAGLVAI-FSMSR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fis1NP_001137607.1 Fis1 9..120 CDD:276936 37/113 (33%)
TPR repeat 33..65 CDD:276936 10/31 (32%)
TPR repeat 69..100 CDD:276936 14/30 (47%)
fis-2NP_001024560.1 Fis1 11..126 CDD:276936 38/119 (32%)
TPR repeat 34..66 CDD:276936 10/31 (32%)
TPR repeat 70..103 CDD:276936 14/32 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166903
Domainoid 1 1.000 44 1.000 Domainoid score I8341
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41099
Inparanoid 1 1.050 77 1.000 Inparanoid score I3832
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58557
OrthoDB 1 1.010 - - D1595957at2759
OrthoFinder 1 1.000 - - FOG0003777
OrthoInspector 1 1.000 - - oto17615
orthoMCL 1 0.900 - - OOG6_102996
Panther 1 1.100 - - LDO PTHR13247
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R448
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.