DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fis1 and fis1

DIOPT Version :9

Sequence 1:NP_001137607.1 Gene:Fis1 / 49892 FlyBaseID:FBgn0039969 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001123678.1 Gene:fis1 / 100170430 XenbaseID:XB-GENE-1008812 Length:151 Species:Xenopus tropicalis


Alignment Length:152 Identity:66/152 - (43%)
Similarity:101/152 - (66%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDLLNEVVPQEDLERFEKKYHHELELDGEVTTDTKFEYAFCLVRSRYTNDVRKGIMILEE-LAR 64
            ||.:|::.|...||.:|||||..|.: .|.::..|:||||:||:||:||:|::||..|||: |.:
 Frog     1 MEAVLSDPVDTGDLLKFEKKYLAERK-SGSLSKGTQFEYAWCLIRSKYTDDIKKGARILEDLLPK 64

  Fly    65 THPDGRRDYIYYLAFGNARIKEYTSGLKYCRAFLDIE-SNDQVRSLEEYIKKEIDKEVAKGMVVA 128
            .:.:.:|||::|||..:.|:|||...|||.|..|..| :|.|...||:.|:|.:.|:...||.:.
 Frog    65 GNKEEQRDYLFYLAVAHYRLKEYEKALKYVRTLLSTEPNNTQALELEKVIEKAMQKDGLVGMAIV 129

  Fly   129 GGAALVLGGILGL-GIAMARNK 149
            ||.||.:.|:.|| |:|:::.|
 Frog   130 GGVALGVAGLAGLIGLAISKAK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fis1NP_001137607.1 Fis1 9..120 CDD:276936 50/112 (45%)
TPR repeat 33..65 CDD:276936 18/32 (56%)
TPR repeat 69..100 CDD:276936 15/30 (50%)
fis1NP_001123678.1 Fis1 8..123 CDD:276936 51/115 (44%)
TPR repeat 32..64 CDD:276936 18/31 (58%)
TPR repeat 69..100 CDD:276936 15/30 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11904
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41099
Inparanoid 1 1.050 120 1.000 Inparanoid score I4622
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595957at2759
OrthoFinder 1 1.000 - - FOG0003777
OrthoInspector 1 1.000 - - oto102772
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6325
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.