DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB21 and F56D1.1

DIOPT Version :9

Sequence 1:NP_001091872.1 Gene:ZBTB21 / 49854 HGNCID:13083 Length:1066 Species:Homo sapiens
Sequence 2:NP_495042.3 Gene:F56D1.1 / 186375 WormBaseID:WBGene00018959 Length:454 Species:Caenorhabditis elegans


Alignment Length:491 Identity:95/491 - (19%)
Similarity:159/491 - (32%) Gaps:187/491 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   605 SPASSSHAVLDEKFQRKLIDIVREREIKKALIIKLRRGKPGFQGQSSSQAQQVIKRNL--RSRAK 667
            |.:|||....|::::.:  |...||...|..|               .:.::|.|..:  |.|.:
 Worm    10 SSSSSSDEDSDDEYREE--DGNSERSNSKVCI---------------EEVEEVEKEEIASRKRKR 57

Human   668 GA-----YICTYCGKAYRFLSQFKQHIKMHPGEKPLGVNKVAKPKEHAPLASPVENKEVYQCRLC 727
            |.     :.|.:|.|.:|:.::.::|||:|...:                         |||..|
 Worm    58 GKTKDEFHPCPFCEKKFRYPNKLREHIKIHDSNR-------------------------YQCLEC 97

Human   728 N--AKLSSLLEQGSHERLCRNAA--VCPYCSLRFFSP---------------------------- 760
            :  .|..:..|..:|.:|..:.|  .||.||.....|                            
 Worm    98 STITKFGTYGELRAHHKLHHSKASHKCPQCSYTNEKPAFIRRHFEQNHVDGIPCTITGCCIKVAK 162

Human   761 -----ELKQEHES------------------KCEYK----------------------------K 774
                 .:|:.|.|                  .||||                            .
 Worm   163 NRLKAHIKEYHTSIPLSTEQTRSKLSFNKCPLCEYKPDVSDDDPEQQQKDLEDHVQRIHEEREPA 227

Human   775 LTCLECMRTFKSSFSIWRHQVEVHNQNNMAPTENFSLPVLDHN-----------GDVTGSSRPQS 828
            |..|.| ..:..|.|:..|.....:.....|:.:.|.|.|.::           ..:||:|   |
 Worm   228 LCTLGC-GVYLGSGSVSEHLSTCSSLIQNIPSSSQSTPALQNDEWNDANTETTLSTITGTS---S 288

Human   829 QPEPNKVNHIVTTKDDNVFSDSSEQVNFDSE----------------DSSC--LPEDLSLSKQLK 875
            |.|.:.|:.:.....:|: :|..|::.|.:.                |.||  ..:..:|...|:
 Worm   289 QFERDSVSEVTNDLSENI-NDIDEEIEFGTTEPPNKIRKHSRSRVHGDFSCEICLKTFTLRDNLR 352

Human   876 IQVKEEPVEEAEEEAPEASTAPKEAGPSKEASLWPCEK---------CGKMFTVHKQLERHQELL 931
            ..|:....|.:::       ..|..|| |....:.|::         |||.|...:.|..|..:.
 Worm   353 KHVRVYHSENSQK-------VVKSTGP-KHQEQYKCDRKSKDGDETTCGKTFRTEQALHDHFNVH 409

Human   932 CSVKPFICHVCNKAFRTNFRLWSHFQSHMSQASEES 967
            ..:||:.||.||:.|....|    |..|:|:..:.|
 Worm   410 DGIKPYSCHTCNQKFHARDR----FAVHLSKYHQTS 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB21NP_001091872.1 BTB 20..120 CDD:279045
Mediates homodimerization 30..96
BTB 31..120 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..196
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..442
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..485
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..525
C2H2 Zn finger 548..569 CDD:275368
zf-C2H2 670..692 CDD:278523 7/21 (33%)
C2H2 Zn finger 672..692 CDD:275370 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 806..840 10/44 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 879..906 5/26 (19%)
C2H2 Zn finger 911..931 CDD:275370 7/28 (25%)
C2H2 Zn finger 939..960 CDD:275370 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 963..1014 1/5 (20%)
F56D1.1NP_495042.3 C2H2 Zn finger 67..87 CDD:275368 7/19 (37%)
C2H2 Zn finger 94..116 CDD:275368 5/21 (24%)
C2H2 Zn finger 338..359 CDD:275368 4/20 (20%)
C2H2 Zn finger 380..409 CDD:275368 7/28 (25%)
C2H2 Zn finger 417..434 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.