DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPRD1 and AstC-R1

DIOPT Version :9

Sequence 1:NP_000902.3 Gene:OPRD1 / 4985 HGNCID:8153 Length:372 Species:Homo sapiens
Sequence 2:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster


Alignment Length:339 Identity:114/339 - (33%)
Similarity:181/339 - (53%) Gaps:38/339 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    55 LYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGEL 119
            ||..||.:||.||.||::.::|::||:|.|||||.|||:||......:||......:.:|.|||.
  Fly    83 LYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYTMRICSWRFGEF 147

Human   120 LCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIM 184
            :|||.:.......|||...|.:||.|||||||||:.:..:||...||:::...|..::.:.:|::
  Fly   148 MCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVI 212

Human   185 VMAVTRPRDGAV--VCMLQFPSP-SWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLL 246
            :.|.|..::..:  .|.:.:|.. ..:..|...:..|...|..|:..|...|.|::.:||||...
  Fly   213 LYASTVEQEDGINYSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPK 277

Human   247 SG--SKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLV-------DIDRRDPLVVAALHL 302
            .|  ||||.|:.|::||:||.|:..:::||.|..|..:  .|:       |:.|.:.|:...|. 
  Fly   278 PGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQV--ALIHSNPAQRDLSRLEILIFLLLG- 339

Human   303 CIALGYANSSLNPVLYAFLDENFKRCF-------------RQLCRKPCGRPDPSSFSR--AREAT 352
              ||.|:||::||:|||||.|||::.|             .||      :.:||.|::  :::..
  Fly   340 --ALVYSNSAVNPILYAFLSENFRKSFFKAFTCMNKQDINAQL------QLEPSVFTKQGSKKRG 396

Human   353 ARERVTACTPSDGP 366
            ..:|:....|...|
  Fly   397 GSKRLLTSNPQIPP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPRD1NP_000902.3 7tm_4 59..>232 CDD:304433 61/175 (35%)
7tm_1 66..318 CDD:278431 91/263 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..372 6/29 (21%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 103/284 (36%)
7tm_1 94..353 CDD:278431 91/263 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X22
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.