DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a22 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:318 Identity:60/318 - (18%)
Similarity:119/318 - (37%) Gaps:88/318 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLDVVALLLIALAVGF------WFVRTRYSYWTR----------RGIGSEPARFPVGNM-EGFRK 48
            ||:::.:..:.| :||      |..|.....|.|          :|......|..:|:| |..:.
plant     1 MLEIITVRKVFL-IGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQM 64

  Fly    49 NKHFIDIVTPIYEKFKGNGAPFAGFFMMLR-----------PVVLVTDLELAKQILIQDFANFED 102
            ::....:..|:...|.....||....::..           |.|:|.|.|..::|:.:       
plant    65 DQVAHSLPLPLDADFLPRMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIMSK------- 122

  Fly   103 RGMYHNERDDPLTG---HLF-----RIDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQV 159
                |.....|..|   |:|     ..:||||...|..::|.|....:|.:.|......:|:.:.
plant   123 ----HELFPKPKIGSHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEE 183

  Fly   160 CGELADNAMCGILEIG------DLMARYTSDVIGRCAF------GVECNGLRNPEAEFAIMGRRA 212
            ...||  :..|.:|:.      ||    |.:::.|.:|      |::...::..:.:..::..||
plant   184 WERLA--SAKGTMELDSWTHCHDL----TRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIRA 242

  Fly   213 FSERRHCKLVDGFIESFPEVARFL------RMRQIHQDITDFYVGIVRETVKQREEQG 264
            .       .:.|        ::||      |:|:..:|:...:..:: ||.::..::|
plant   243 V-------YIPG--------SKFLPTKFNRRLRETERDMRAMFKAMI-ETKEEEIKRG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 50/268 (19%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.