DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a22 and CYP705A28

DIOPT Version :9

Sequence 1:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001154631.1 Gene:CYP705A28 / 3768880 AraportID:AT3G20935 Length:348 Species:Arabidopsis thaliana


Alignment Length:316 Identity:74/316 - (23%)
Similarity:126/316 - (39%) Gaps:70/316 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 IMGRRAFSERRHCKLVDGF-IESF---PEVARFLRMRQIHQDITDFYVGIVRETVK--------- 258
            ||||....:....:.|.|. |||.   |::  ||.| ..|:.:....:.:.::.:|         
plant     2 IMGRSCSEKNGEAERVRGLVIESLALSPKI--FLGM-IFHKPLKKLGISLFQKDIKSVSPKFDEL 63

  Fly   259 ----------QREEQGIVRSDFMNLLIE-MKQR-------------------------GELTIEE 287
                      :.||.....:|.|:||:| |:.|                         |:.:...
plant    64 LEKFLVEHEEKMEEDHYKANDMMDLLLEAMEMRMQNVNLCIKRVSNTKARKPPILFRYGKYSNNS 128

  Fly   288 MAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQAL---RLHNGEFTYDSMQELRY 349
            :..|..:  .||.||||....:.:.||...|.:..:|||||:..:   ||    .....:..|.|
plant   129 LLLQELL--VAGTDTSALATQWTMAELINNPTILERLREEIESVVGNTRL----IQETDLSNLPY 187

  Fly   350 MELVIAETLRKYPILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPE 414
            ::.|:.|.||.:|......|:|:......|   |||....:|::..|.|..||..:.:|.:|.||
plant   188 LQSVVKEGLRLHPPASISVRMSQERCELGG---FYIPEKTLLVVNTYAIMRDPNFWEDPEEFKPE 249

  Fly   415 RFLADQLAQR------PTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSV 464
            ||:....:::      ....::||..|.|.|.|.....:...|.:..:::.|.:.:
plant   250 RFITSSRSEQEDEMREEVLKYIPFSAGRRGCPGSNLAYVSLGIAIGVMVQCFDWRI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 74/316 (23%)
CYP705A28NP_001154631.1 p450 <13..346 CDD:299894 70/305 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.