DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a22 and Cyp49a1

DIOPT Version :9

Sequence 1:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001246256.1 Gene:Cyp49a1 / 36105 FlyBaseID:FBgn0033524 Length:589 Species:Drosophila melanogaster


Alignment Length:389 Identity:91/389 - (23%)
Similarity:160/389 - (41%) Gaps:73/389 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LFRIDGPKWRPLRQKMSPTF---TSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEI----- 174
            |..:.||||...||::....   .:|| ||:.|        |..:..|     ..|.:|:     
  Fly   202 LIGVHGPKWEAFRQEVQHILLQPQTAK-KYIPP--------LNDIASE-----FMGRIELMRDEK 252

  Fly   175 GDLMARYTSDV-------IGRCAFGVECNGLRNPEAEFAIMGRRAFSE--RRHCKLVDGFIESFP 230
            .:|.|.:..::       :||.:..... |..:||.          ||  ::..:.::.|..:.|
  Fly   253 DELPANFLHELYKWALESVGRVSLDTRL-GCLSPEG----------SEEAQQIIEAINTFFWAVP 306

  Fly   231 EVARFLRM-----------RQIHQDITDF------YVGIVRETVKQREEQGIVRSDFMNLLIEMK 278
            |:.  |||           |...:.:..|      .:|...:.....|.:|:.:|:....::|..
  Fly   307 ELE--LRMPLWRIYPTKAYRSFVKALDQFTAICMKNIGKTMDKADADEARGLSKSEADISIVERI 369

  Fly   279 QRGELTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDS 343
            .|.....:..|..|...|..|.||::......:|:|||.|..|.||.:|:.:.......:...:.
  Fly   370 VRKTGNRKLAAILALDLFLVGVDTTSVAASSTIYQLAKNPDKQKKLFDELQKVFPHREADINQNV 434

  Fly   344 MQELRYMELVIAETLRKYPILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEP 408
            ::::.|:...:.||||..|:   :....|.|.:......:::..|..::.|...:.:|||.:|||
  Fly   435 LEQMPYLRACVKETLRMRPV---VIANGRSLQSDAVINGYHVPKGTHVIFPHLVVSNDPAYFPEP 496

  Fly   409 HKFIPERFL--ADQLAQRPTA-------AWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFS 463
            .:|:|||:|  :...|..|.|       ..||||.|.|.|:|.||.:::....|..:.|.:..|
  Fly   497 KRFLPERWLKQSTDAAGCPHANQKIHPFVSLPFGFGRRMCVGRRFAEIELHTLLAKIFRKYKVS 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 91/389 (23%)
Cyp49a1NP_001246256.1 p450 104..565 CDD:299894 91/389 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.