DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a22 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:453 Identity:116/453 - (25%)
Similarity:194/453 - (42%) Gaps:84/453 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VVLVTDLELAKQI-----LIQDFANFE------DRGMYHNERDDPLTGHLFRIDGPKWRPLRQKM 133
            :|:.||.|..||:     |:....|:|      .:|:..|             .|..|...|:.:
  Fly    76 MVMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTN-------------GGESWHRRRKLL 127

  Fly   134 SPTFTSAKMKYMFPTVCEVGEELTQVC----GELADNAMCGILEIGDLMARYTSDVIGRCAFGVE 194
            :|.|       .|..:.|..|.:.:.|    ..|...|.....:|...:..:..|.|...|.|::
  Fly   128 TPGF-------HFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGIK 185

  Fly   195 CNGLRNPEAEFA--------IMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQIHQDITDFYVG 251
            .:.....::|:.        :|.:::||..:...:.  |..:.|...|...::.:| |.|:..:.
  Fly   186 KHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVF--FKHTKPGKEREAALKVLH-DETNRVIR 247

  Fly   252 IVRETV-------KQREEQGIV----RSDFMNLLI--EMKQRGELTIEEMAAQAFIFFAAGFDTS 303
            :.||.:       |...||..|    |..|:::|:  :|:...||:..::..:...|...|.||:
  Fly   248 LRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTT 312

  Fly   304 ASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQLT 368
            :|.:.|||..|:|.|.:|.:..||   |..|...|     .:.:.|:|.||.||||.||.:|..:
  Fly   313 SSAIAFALSLLSKNPDVQQRAFEE---ASELEGRE-----KESMPYLEAVIKETLRIYPSVPFFS 369

  Fly   369 R-ISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPF 432
            | :...|...|    ..:..|..:...:|.:|.||..:|:|.:|.|:|||.::....| .|:..|
  Fly   370 RKVLEDLEVGK----LTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHP-FAFAAF 429

  Fly   433 GDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTD----PKIEFLKSNILLCPANGIYLKV 491
            ..|||||||.:|..::....|..|||::.|  .|..|    |..|.:..:     .|||.|::
  Fly   430 SAGPRNCIGQKFAMLELKTSLAMLLRSYRF--LPDKDHQPKPLAELVTKS-----GNGIRLRI 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 116/451 (26%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 110/430 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.